PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G239400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 217aa    MW: 24287.8 Da    PI: 8.2913
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G239400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR130.61.1e-0923565689
                  FAR1 56 aetrtgCkaklkvkkekdgkwevtkleleHnHel 89
                          a+ rt+Cka++++++++d+ w++++++ eHnH++
  Sobic.004G239400.1.p 23 ATCRTDCKAMIRLHRTSDHGWVISSFVAEHNHPC 56
                          5679****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.9E-72356IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MLVVDSDFLF FSPKGLCLNS MAATCRTDCK AMIRLHRTSD HGWVISSFVA EHNHPCSGTY  60
GQNKQWLSHS DIDPMTKDFV RKLRDNNIPI GRVCSILGVH GSESAIPIRK EAVRSLCARI  120
AQDNIKDDIG KTMSLLDNMK TNDVGMEIRF KLDDDEKIKS MLWCTGKNRA DYAKFGDVVT  180
FDTTYRTNLY NLPFGLFVGV NNHFQTLSGL SPSSQK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442202.12e-84hypothetical protein SORBIDRAFT_08g016320
TrEMBLC5YP292e-84C5YP29_SORBI; Putative uncharacterized protein Sb08g016320
STRINGSb08g016320.17e-84(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6191991
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22170.23e-21far-red elongated hypocotyls 3